General Information

  • ID:  hor000763
  • Uniprot ID:  P20616
  • Protein name:  Secretoneurin
  • Gene name:  SCG2
  • Organism:  Bos taurus (Bovine)
  • Family:  Chromogranin/secretogranin protein family
  • Source:  animal
  • Expression:  [Secretoneurin]: Highest levels detected in anterior pituitary followed by adrenal medulla and posterior pituitary (at protein level) .
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Bos (genus), Bovinae (subfamily), Bovidae (family), Pecora (infraorder), Ruminantia (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005125 cytokine activity; GO:0042056 chemoattractant activity
  • GO BP:  GO:0000165 MAPK cascade; GO:0001525 angiogenesis; GO:0001938 positive regulation of endothelial cell proliferation; GO:0035556 intracellular signal transduction; GO:0048245 eosinophil chemotaxis; GO:0050918 positive chemotaxis; GO:0050930 induction of positive chemotaxis; GO:2000352 negative regulation of endothelial cell apoptotic process; GO:2001237 negative regulation of extrinsic apoptotic signaling pathway
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0030141 secretory granule; GO:0031045 dense core granule; GO:0098992 neuronal dense core vesicle

Sequence Information

  • Sequence:  TNEIVEEQYTPQNLATLESVFQELGKLTGPNSQ
  • Length:  33
  • Propeptide:  MAEAKTHWLGAVLSLIPLIFLLSEAEAASFQRNQLLQKEPDLRLENVQRFPSPEMIRALEYIEKLRQQAHKEESSPDYNPYQGVSVPLQQKENGDLPESSRDSLSEDEWMKIIAEALRQAENEPQSAPKENKPYTLNSEKNFPMDMPDDYETQQWAERKLKHMRFPPMYEENSRDNPFKRTNEIVEEQYTPQNLATLESVFQELGKLTGPNSQKRERADEEQKLYTDDEDDIYKANNIAYEDVVGGEDWNPVEEKIESQTQEEVRDSKENADKTEQINDEMKRSGQLGLQDEDLRKESKDQLSDDVSKVITYLKRLVNAAGSGRSQNGQTGERAIRLFEKPLDPQSIYQLIEISRNLQIPPEDLIDMLKTGEKPVEPEQELEIPVEPEDISEVDLDHPDLFQNKMLSKNGYPKAPGHAVAEALSEGLSVEDILNLLGMESAANPKPPYFPNQYNREKVLSRLPYGPGRSKANQLPKAVWMPDVENRQMAYENLNDKDQELGEYLARMLVKYPEIMNANPAKRVPSQGSTEDDRQDENQIEQALKEHLSQHSSQETDKLASVSKRLPVGTPKSDDTPNRPYLDEDLLVKVLEYLNQEKAEKGREHIAKRAMENM
  • Signal peptide:  MAEAKTHWLGAVLSLIPLIFLLSEAEA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Regulate the biogenesis of secretory granules
  • Mechanism:  Binds calcium with a low-affinity.
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P20616-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor000763_AF2.pdbhor000763_ESM.pdb

Physical Information

Mass: 424996 Formula: C160H253N41O58
Absent amino acids: CDHMRW Common amino acids: E
pI: 3.71 Basic residues: 1
Polar residues: 12 Hydrophobic residues: 9
Hydrophobicity: -69.39 Boman Index: -5955
Half-Life: 7.2 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 79.7
Instability Index: 3461.82 Extinction Coefficient cystines: 1490
Absorbance 280nm: 46.56

Literature

  • PubMed ID:  9654353
  • Title:  Formation and sequence analysis of secretoneurin, a neuropeptide derived from secretogranin II, in mammalian, bird, reptile, amphibian and fish brains.